The domain within your query sequence starts at position 250 and ends at position 318; the E-value for the E1_4HB domain shown below is 2.5e-22.
PKTVRHKPLDIALLQPHVVAQNTQEVQRAHCLHQAFHVLHKFQQLHGRLPKPWDPDDAET VVELAQDLE
E1_4HB |
![]() |
---|
PFAM accession number: | PF16191 |
---|---|
Interpro abstract (IPR032420): | This domain is found in the ubiquitin-activating E1 family enzymes and is C-terminal to the FCCH domain [ (PUBMED:18662542) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_4HB