The domain within your query sequence starts at position 171 and ends at position 204; the E-value for the EABR domain shown below is 8.6e-22.
EMQLKDALEKNQQWLVYDQQREAYVKGLLAKIFE
EABR |
---|
PFAM accession number: | PF12180 |
---|---|
Interpro abstract (IPR022008): | This domain family is found in eukaryotes, and is approximately 40 amino acids in length. This domain is the active domain of CEP55. CEP55 is a protein involved in cytokinesis, specifically in abscission of the plasma membrane at the midbody. To perform this function, CEP55 complexes with ESCRT-I (by a Proline rich sequence in its TSG101 domain) and ALIX. This is the domain on CEP55 which binds to both TSG101 and ALIX. It also acts as a hinge between the N and C termini. This domain is called EABR. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EABR