The domain within your query sequence starts at position 2636 and ends at position 2808; the E-value for the EB1_binding domain shown below is 2.9e-90.

RSGRSPTGNTPPVIDSVSEKGSSSIKDSKDTHGKQSVGSGSPVQTVGLETRLNSFVQVEA
PEQKGTEAKPGQSNPVSIAETAETCIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSP
RKSSADSTSARPSQIPTPVSTNTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV

EB1_binding

 EB1_binding
PFAM accession number:PF05937
Interpro abstract (IPR009232):

This region at the C terminus of the APC proteins binds the microtubule-associating protein EB-1 [ (PUBMED:11514192) ]. At the C terminus of the alignment is also a PDZ-binding domain. A short motif in the middle of the region appears to be found in the APC2 proteins (e.g. O95996 ).

GO process:Wnt signaling pathway (GO:0016055)
GO function:beta-catenin binding (GO:0008013)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EB1_binding