The domain within your query sequence starts at position 144 and ends at position 232; the E-value for the EF-hand_3 domain shown below is 1.4e-38.
MLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCFPQQKK IMLNMFLDTMMADPPPQCLVWLPLMHRLA
EF-hand_3 |
![]() |
---|
PFAM accession number: | PF09069 |
---|---|
Interpro abstract (IPR015154): | Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions. The main function of this domain is the provision of specificity in beta-dystroglycan recognition, though in dystrophin it serves an additional role: stabilisation of the WW domain ( IPR001202 ), enhancing dystroglycan binding [ (PUBMED:10932245) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_3