SMART: Pfam domain EF-hand

The domain within your query sequence starts at position 108 and ends at position 175; the E-value for the EF-hand_9 domain shown below is 8e-31.

NSTFEACDPHKTGTVTVAHLLAYLEAVTGQGPQDVRLQTLARSLDPYGEGAGATVELDTF
LVVMRDWI

EF-hand_9

PFAM accession number:	PF14658
Interpro abstract (IPR039508):	This entry represents the EF-hand-like domain found in protein KASH5. KASH5 is a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton [ (PUBMED:26842404) ]. It interacts (via the last 22 AA) with SUN1; this interaction mediates telomere localisation [ (PUBMED:22826121) ]. Proteins containing this domain also include lrmp from Zebra fish. It is a maternally expressed membrane and cytoskeletal linker protein, which is essential for attachment of the centrosome to the male pronucleus [ (PUBMED:22542100) ].

PFAM accession number:

PF14658

Interpro abstract (IPR039508):

This entry represents the EF-hand-like domain found in protein KASH5. KASH5 is a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton [ (PUBMED:26842404) ]. It interacts (via the last 22 AA) with SUN1; this interaction mediates telomere localisation [ (PUBMED:22826121) ].

Proteins containing this domain also include lrmp from Zebra fish. It is a maternally expressed membrane and cytoskeletal linker protein, which is essential for attachment of the centrosome to the male pronucleus [ (PUBMED:22542100) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_9