The domain within your query sequence starts at position 228 and ends at position 310; the E-value for the EF-hand_like domain shown below is 2.3e-26.
DLYLLLLSYSDKKDHLTVEELAQFLKVEQKMSNVTLDYCLDIIMKFEVSEENKVKNVLGI EGFTNFMRSPACDVFNPLHHEVY
EF-hand_like |
![]() |
---|
PFAM accession number: | PF09279 |
---|---|
Interpro abstract (IPR015359): | This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C. It adopts a structure consisting of a core of four alpha helices, in an EF like fold, and is required for functioning of the enzyme [ (PUBMED:8784353) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_like