The domain within your query sequence starts at position 3 and ends at position 110; the E-value for the EFTUD2 domain shown below is 1.1e-42.
TDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDEDEDEDDVGEHEDDHPGMEVVLHED KKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLP
EFTUD2 |
 |
|---|
| PFAM accession number: | PF16004 |
|---|---|
| Interpro abstract (IPR031950): | This entry represents the N-terminal domain of U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116kDa). It is also found in Snu114p, a 114kDa protein homologous to U5-116kDa that has been identified in Saccharomyces cerevisiae [ (PUBMED:9233818) ]. Both proteins seem to have a role in pre-mRNA splicing process. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EFTUD2