The domain within your query sequence starts at position 231 and ends at position 319; the E-value for the EF_assoc_2 domain shown below is 5.3e-36.
NTPLAPQALEDVKNVVRKHLSDGVADSGLTLRGFLFLHTLFIQRGRHETTWTVLRRFGYD DDLDLTPEYLFPLLKIPPDCTTELNHHAY
EF_assoc_2 |
![]() |
---|
PFAM accession number: | PF08356 |
---|---|
Interpro abstract (IPR013567): | This region predominantly appears near EF-hands ( IPR002048 ) in GTP-binding proteins. It is found in all three eukaryotic kingdoms. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF_assoc_2