The domain within your query sequence starts at position 24 and ends at position 56; the E-value for the EHD_N domain shown below is 1.2e-19.
GLRQLYAQKLLPLEEHYRFHEFHSPALEDADFD
EHD_N |
![]() |
---|
PFAM accession number: | PF16880 |
---|---|
Interpro abstract (IPR031692): | This is a short domain that lies at the very N terminus of many dynamins and EF-hand domain-containing proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EHD_N