SMART: Pfam domain EIF4E-T

The domain within your query sequence starts at position 98 and ends at position 327; the E-value for the EIF4E-T domain shown below is 5.1e-41.

AGIVECNGGVAEEDEVEVILAQEPSADQEVPRDVILPEQSPGEFDFNEFFNLDKVPCLAS
MIEDVLGEGSVSASRFSRWFSNPSRSGSRSSSLGSTPHEELERLAGLEQAVLSPGQNSGN
YFAPIPSEDHAENKVDILEMLQKAKVDLKPLLSSLSANKEKLKESSHSGVVLSVEEVEAG
LKGLKVDQQMKNSTPFMAEHLEETLSAASSNRQLKKDGDMTAFNKLVNTM

EIF4E-T

PFAM accession number:	PF10477
Interpro abstract (IPR018862):	This entry represents a group of eIF4E binding proteins, including eIF4E transporter (eIF4E-T) from mammals, cup protein from D. melanogaster and ifet-1 from C. elegans. Protein cup functions in Smaug-mediated translational repression [ (PUBMED:14685270) (PUBMED:21081899) ]. Ifet-1 is a broad-scale translational repressor in C. elegans [ (PUBMED:19786575) (PUBMED:23264733) ]. eIF4E-T is the transporter protein for shuttling the mRNA cap-binding protein eIF4E protein, targeting it for nuclear import. eIF4E-T contains several key binding domains including two functional leucine-rich NESs (nuclear export signals) between residues 438-447 and 613-638 in the human protein. The other two binding domains are an eIF4E-T-binding site, between residues 27-42 in Q9EST3 and a bipartite NLS (nuclear localisation signals) between 194-211, and these lie in family eIF4E-T_N. eIF4E-T is the eukaryotic translation initiation factor 4E that is the rate-limiting factor for cap-dependent translation initiation [ (PUBMED:10856257) ].

PFAM accession number:

PF10477

Interpro abstract (IPR018862):

This entry represents a group of eIF4E binding proteins, including eIF4E transporter (eIF4E-T) from mammals, cup protein from D. melanogaster and ifet-1 from C. elegans.

Protein cup functions in Smaug-mediated translational repression [ (PUBMED:14685270) (PUBMED:21081899) ].

Ifet-1 is a broad-scale translational repressor in C. elegans [ (PUBMED:19786575) (PUBMED:23264733) ].

eIF4E-T is the transporter protein for shuttling the mRNA cap-binding protein eIF4E protein, targeting it for nuclear import. eIF4E-T contains several key binding domains including two functional leucine-rich NESs (nuclear export signals) between residues 438-447 and 613-638 in the human protein. The other two binding domains are an eIF4E-T-binding site, between residues 27-42 in Q9EST3 and a bipartite NLS (nuclear localisation signals) between 194-211, and these lie in family eIF4E-T_N. eIF4E-T is the eukaryotic translation initiation factor 4E that is the rate-limiting factor for cap-dependent translation initiation [ (PUBMED:10856257) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EIF4E-T