The domain within your query sequence starts at position 722 and ends at position 955; the E-value for the ELYS domain shown below is 2.5e-58.
CLMIDGLVSQLGDEVEKLWKRDEGGTGRYPPASIHALLDIYLLDNITEASKHAITIYLLL DIMYSFPNKTDTPIESFPTAFAISWGQVKLVQGFWLLDHNDYENGLDLLFHPVTAKPASW QHSKIIEAFMSQGEHKQALRYLQTMKPTVSSSNEVILHLTVLLFNRCMVEAWNLLRQNSN RVNIEELLKHAYEVCQEMGLMEDLLKLPFTNTEQECLVKFLQSSTSVENHEFLL
ELYS |
---|
PFAM accession number: | PF13934 |
---|---|
Interpro abstract (IPR025151): | This domain is found in ELYS (embryonic large molecule derived from yolk sac), which is conserved from fungi such Aspergillus nidulans and Schizosaccharomyces pombe to humans [ (PUBMED:17235358) ]. ELYS is important for the assembly of the nuclear pore complex [ (PUBMED:19019988) ]. The domain is also found in other proteins, such as E3 ubiquitin-protein ligase HOS1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELYS