The domain within your query sequence starts at position 45 and ends at position 238; the E-value for the EMG1 domain shown below is 2.9e-87.
VVLEGASLETVKVGKTYELLNCDRHKSMLLKNGRDPGEVRPDITHQSLLMLMDSPLNRAG LLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQLLHKLSVRAADGPQKLLKVIKNPVS DHFPVGCMKIGTSFSVEDISDIRELVPSSDPVVFVVGAFAHGKVSVEYTEKMVSISNYPL SAALTCAKVTTAFE
EMG1 |
![]() |
---|
PFAM accession number: | PF03587 |
---|---|
Interpro abstract (IPR005304): | Members of this family are essential for 40S ribosomal biogenesis. They play a role in the methylation reaction of pre-rRNA processing. The structure of EMG1 has revealed that it is a novel member of the superfamily of alpha/beta knot fold methyltransferases [ (PUBMED:18063569) (PUBMED:11935223) ]. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EMG1