The domain within your query sequence starts at position 1 and ends at position 99; the E-value for the EPL1 domain shown below is 1.3e-19.

MEHHLQRAISAQQVYGEKRDNMVIPVPEAESNIAYYESIYPGEFRMPKQLIHIQPFSLDA
EQPDYDLDSEDEVFVNKLKKKMDICPLQFEEMIDRLEKG

EPL1

EPL1
PFAM accession number:PF10513
Interpro abstract (IPR019542):

This domain is found at the N-terminal of EPL1 (Enhancer of polycomb-like) proteins. The EPL1 protein is a member of a histone acetyltransferase complex which is involved in transcriptional activation of selected genes [ (PUBMED:15964809) ]. It is also present at the N terminus of Jade family proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EPL1