The domain within your query sequence starts at position 7 and ends at position 300; the E-value for the ERG4_ERG24 domain shown below is 6.4e-75.

SQAPLEFGGPLGVAALLILLPATMFHLLLAARSGPARLLALPAYLPGLEELWSPWALLLL
FIWLGLQVALYLLPARKVAEGLELKDKSRLRYPINGFQALVLTALLMGLGVSVGLPLGAL
PGMLLPLAFATTLTSFIFSLLLYAKALVAPASALAPGGNSGNSMYDFFLGRELNPRLGSF
DFKYFCELRPGLIGWVFINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWYEESVLT
TMDIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLLKGLE

ERG4_ERG24

ERG4_ERG24
PFAM accession number:PF01222
Interpro abstract (IPR001171):

The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis. They act by reducing double bonds in precursors of ergosterol [ (PUBMED:8125337) ]. These proteins are highly hydrophobic and seem to contain seven or eight transmembrane regions. Chicken lamin B receptor that is thought to anchor the lamina to the inner nuclear membrane belongs to this family.

GO process:sterol biosynthetic process (GO:0016126)
GO component:membrane (GO:0016020)
GO function:oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor (GO:0016628)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERG4_ERG24