The domain within your query sequence starts at position 75 and ends at position 225; the E-value for the ERG4_ERG24 domain shown below is 1.3e-35.
HASLADIWAKTPPVTAKAAQLYALWVSFQGYLFPTSAEDCKFTGNFFYNYMMGIEFNPRI GKWFDFKLFFNGRPGIVAWTLINLSFAAKQQELYGHVTNSMILVNVLQAIYVLDFFWNET WYLKTIDICHDHFGWYLGWGDCVWLPYLYTL
ERG4_ERG24 |
![]() |
---|
PFAM accession number: | PF01222 |
---|---|
Interpro abstract (IPR001171): | The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis. They act by reducing double bonds in precursors of ergosterol [ (PUBMED:8125337) ]. These proteins are highly hydrophobic and seem to contain seven or eight transmembrane regions. Chicken lamin B receptor that is thought to anchor the lamina to the inner nuclear membrane belongs to this family. |
GO process: | sterol biosynthetic process (GO:0016126) |
GO component: | membrane (GO:0016020) |
GO function: | oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor (GO:0016628) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERG4_ERG24