SMART: Pfam domain ERGIC

The domain within your query sequence starts at position 5 and ends at position 98; the E-value for the ERGIC_N domain shown below is 1.1e-39.

FRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKD
SGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEV

ERGIC_N

PFAM accession number:	PF13850
Interpro abstract (IPR039542):	Proteins included in this entry are conserved from plants and fungi to humans. Erv46 (ERGIC3) works in close conjunction with Erv41 (ERGIC2) and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58kDa beta subunit, which is required for ER localisation. All proteins identified biochemically as Erv41p-Erv46p interactors are localised to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi [ (PUBMED:17077122) ]. This entry represents the N-terminal domain of the endoplasmic reticulum vesicle transporter proteins (Ervs), also known as endoplasmic reticulum-Golgi intermediate compartment (ERGIC) proteins. Proteins containing this domain also include disulfide isomerase (PDI)-C subfamily members from Arabidopsis. They are chimeric proteins containing the thioredoxin (Trx) domain of PDIs, and the conserved N- and C-terminal Pfam domains of Erv cargo receptors [ (PUBMED:28444333) ].

PFAM accession number:

PF13850

Interpro abstract (IPR039542):

Proteins included in this entry are conserved from plants and fungi to humans. Erv46 (ERGIC3) works in close conjunction with Erv41 (ERGIC2) and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58kDa beta subunit, which is required for ER localisation. All proteins identified biochemically as Erv41p-Erv46p interactors are localised to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi [ (PUBMED:17077122) ].

This entry represents the N-terminal domain of the endoplasmic reticulum vesicle transporter proteins (Ervs), also known as endoplasmic reticulum-Golgi intermediate compartment (ERGIC) proteins.

Proteins containing this domain also include disulfide isomerase (PDI)-C subfamily members from Arabidopsis. They are chimeric proteins containing the thioredoxin (Trx) domain of PDIs, and the conserved N- and C-terminal Pfam domains of Erv cargo receptors [ (PUBMED:28444333) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERGIC_N