The domain within your query sequence starts at position 60 and ends at position 453; the E-value for the ERO1 domain shown below is 3.7e-128.
RLFPRLQKLLESDYFRYYKVNLKKPCPFWNDINQCGRRDCAVKPCHSDEVPDGIKSASYK YSEEANRIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDSFCEIDDIQSPDAEYVD LLLNPERYTGYKGPDAWRIWSVIYEENCFKPQTIQRPLASGRGKSKENTFYNWLEGLCVE KRAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNVTEFQQRFDGILTEGEGPRRLRN LYFLYLIELRALSKVLPFFERPDFQLFTGNKVQDAENKALLLEILHEIKSFPLHFDENSF FAGDKNEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIAN MPESGPSYEFQLTRQEIVSLFNAFGRISTSVREL
ERO1 |
![]() |
---|
PFAM accession number: | PF04137 |
---|---|
Interpro abstract (IPR007266): | This entry represents endoplasmic oxidoreductin-1 (Ero1) from yeast and its homologues from mammals, Ero1-Lalpha and Ero1-Lbeta. Ero1 is an essential oxidoreductase that oxidises proteins in the endoplasmic reticulum to produce disulfide bonds [ (PUBMED:10754564) (PUBMED:10982384) (PUBMED:22412017) ]. The activity of Ero1 is regulated by Pdi1, which is a protein disulfide isomerase. This regulation of Ero1 through reduction and oxidation of regulatory bonds within Ero1 is essential for maintaining the proper redox balance in the ER [ (PUBMED:22412017) (PUBMED:18971943) ]. |
GO process: | oxidation-reduction process (GO:0055114) |
GO component: | endoplasmic reticulum (GO:0005783) |
GO function: | protein disulfide isomerase activity (GO:0003756), oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor (GO:0016671) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERO1