The domain within your query sequence starts at position 28 and ends at position 169; the E-value for the ER_lumen_recept domain shown below is 3.3e-54.

SCAGISGKSQILFALVFTTRYLDLFSNFISIYNTVMKVVFLLCAYVTVYMIYWKFRKTFD
IENDTFRLEFLLVPVTGLSFLVNYSYTPMEVLWTFSIYLESVAILPQLFMISKTGEAETI
TTHYLFFLGLYRLLYLANWIRR

ER_lumen_recept

 ER_lumen_recept
PFAM accession number:PF00810
Interpro abstract (IPR000133):

Proteins resident in the lumen of the endoplasmic reticulum (ER) contain a C-terminal tetrapeptide, commonly known as Lys-Asp-Glu-Leu (KDEL) in mammals and His-Asp-Glu-Leu (HDEL) in yeast (Saccharomyces cerevisiae) that acts as a signal for their retrieval from subsequent compartments of the secretory pathway. The receptor for this signal is a ~26kDa Golgi membrane protein, initially identified as the ERD2 gene product in S. cerevisiae. The receptor molecule, known variously as the ER lumen protein retaining receptor or the 'KDEL receptor', is believed to cycle between the cis side of the Golgi apparatus and the ER. It has also been characterised in a number of other species, including plants, Plasmodium, Drosophila and mammals. In mammals, 2 highly related forms of the receptor are known.

The KDEL receptor is a highly hydrophobic protein of 220 residues; its sequence exhibits 7 hydrophobic regions, all of which have been suggested to traverse the membrane [ (PUBMED:8392934) ]. More recently, however, it has been suggested that only 6 of these regions are transmembrane (TM), resulting in both N- and C-termini on the cytoplasmic side of the membrane.

GO process:protein retention in ER lumen (GO:0006621)
GO component:integral component of membrane (GO:0016021)
GO function:ER retention sequence binding (GO:0046923)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ER_lumen_recept