The domain within your query sequence starts at position 637 and ends at position 742; the E-value for the EST1 domain shown below is 1.8e-18.
NVDQILWKNAFYQVIEKFRQLLKDPNSENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYK FKLEDYMDGLAIRSKPLRKTVKYALISAQRSMICQGDISRYREQAN
EST1 |
---|
PFAM accession number: | PF10374 |
---|---|
Interpro abstract (IPR019458): | Est1 is directly involved in telomere replication. It associates with telomerase and, during its interaction with CDC13, telomerase activity is promoted [ (PUBMED:12169735) (PUBMED:12454059) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EST1