The domain within your query sequence starts at position 210 and ends at position 293; the E-value for the ETF_alpha domain shown below is 6.4e-40.
PELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGKI VAPELYIAVGISGAIQHLAGMKDS
ETF_alpha |
---|
PFAM accession number: | PF00766 |
---|---|
Interpro abstract (IPR014731): | Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems. They can be functionally classified into constitutive, "housekeeping" ETFs, mainly involved in the oxidation of fatty acids (Group I), and ETFs produced by some prokaryotes under specific growth conditions, receiving electrons only from the oxidation of specific substrates (Group II) [ (PUBMED:8599534) ]. ETFs are heterodimeric proteins composed of an alpha and beta subunit, and contain an FAD cofactor and AMP [ (PUBMED:2326318) (PUBMED:8525056) (PUBMED:8962055) (PUBMED:10026281) (PUBMED:12567183) ]. ETF consists of three domains: domains I and II are formed by the N- and C-terminal portions of the alpha subunit, respectively, while domain III is formed by the beta subunit. Domains I and III share an almost identical alpha-beta-alpha sandwich fold, while domain II forms an alpha-beta-alpha sandwich similar to that of bacterial flavodoxins. FAD is bound in a cleft between domains II and III, while domain III binds the AMP molecule. Interactions between domains I and III stabilise the protein, forming a shallow bowl where domain II resides. This entry represents the C-terminal domain of the alpha subunit of both Group I and Group II ETFs. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ETF_alpha