The domain within your query sequence starts at position 35 and ends at position 184; the E-value for the Eaf7 domain shown below is 7e-18.

VEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESE
ILPFPNPERNFVLPDEIIQEVREGKVVIEEEMKEEMKEDVDPHSGADDVFSSSGSLGKAL
EKSSKDKEKNSSDLGCKEGADKRKRSRVTD

Eaf7

 Eaf7
PFAM accession number:PF07904
Interpro abstract (IPR012423):

This entry includes fungal chromatin modification-related protein Eaf7 and its mammalian homologue, MRG/MORF4L-binding protein (MRGBP). Eaf7/MRGBP is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A [ (PUBMED:15353583) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634), H4/H2A histone acetyltransferase complex (GO:0043189)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Eaf7