The domain within your query sequence starts at position 13 and ends at position 187; the E-value for the Ebp2 domain shown below is 4.8e-65.
LSGLKQCLAEFRRDLEWVERLDVTLGPVPEVSETQPTPQNQDQKKGVNPEDDFQREMSFY RQAQAAVLAVLPRLHQLQVPTKRPTDYFAEMAKSDQQMQKIRQKLQTKQAAMEKSEKAKQ LRALRKYGKKVQTEVLQKRQREKAHMMNAIKKYQKGFSDKLDFLEGDQKPVERS
Ebp2 |
---|
PFAM accession number: | PF05890 |
---|---|
Interpro abstract (IPR008610): | This family consists of several eukaryotic rRNA processing protein EBP2 sequences. Ebp2p is required for the maturation of 25S rRNA and 60S subunit assembly. Ebp2p may be one of the target proteins of Rrs1p for executing the signal to regulate ribosome biogenesis [ (PUBMED:10947841) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ebp2