The domain within your query sequence starts at position 2 and ends at position 82; the E-value for the Elf1 domain shown below is 1.3e-36.
GRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPI TYLSEPVDVYSDWIDACEAAN
Elf1 |
 |
|---|
| PFAM accession number: | PF05129 |
|---|---|
| Interpro abstract (IPR007808): | Transcription elongation factor 1 (Elf1) is a transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions [ (PUBMED:16260625) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Elf1