The domain within your query sequence starts at position 565 and ends at position 663; the E-value for the Elongin_A domain shown below is 7.2e-31.

IFEVGGVPYSVLEPVLERCTPDQLYRIEECNHVLIEETDQLWKVHCHRDFKEERPEEYES
WREMYLRLQDAREQRLRLLTNNIRSAHANKPKGRQAKMA

Elongin_A

Elongin_A
PFAM accession number:PF06881
Interpro abstract (IPR010684):

This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A. In mammals, the Elongin complex activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin is a heterotrimer composed of A, B, and C subunits of 110, 18, and 15 kilodaltons, respectively. Subunit A has been shown to function as the transcriptionally active component of Elongin [ (PUBMED:7660129) ].

GO process:transcription elongation from RNA polymerase II promoter (GO:0006368)
GO component:nucleus (GO:0005634), elongin complex (GO:0070449)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Elongin_A