The domain within your query sequence starts at position 550 and ends at position 621; the E-value for the EphA2_TM domain shown below is 5e-24.
IAGTAVVGVVLVLVVVIIAVLCLRKQSNGREVEYSDKHGQYLIGHGTKVYIDPFTYEDPN EAVREFAKEIDV
EphA2_TM |
![]() |
---|
PFAM accession number: | PF14575 |
---|---|
Interpro abstract (IPR027936): | This entry represents the left-handed dimer transmembrane domain of Ephrin receptors. This domain oligomerises and is important for the active signalling process [ (PUBMED:20197042) ]. Proteins containing this domain include the ephrin type-A and type-B receptors. Ephrin receptors (Ephs) are a group of receptor tyrosine kinases that are activated in response to binding ephrin ligands residing on adjacent cells [ (PUBMED:12094214) ]. This binding leads to contact-dependent bidirectional signaling into neighbouring cells [ (PUBMED:12094214) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EphA2_TM