The domain within your query sequence starts at position 11 and ends at position 125; the E-value for the Erf4 domain shown below is 3.2e-38.
KVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEI
Erf4 |
![]() |
---|
PFAM accession number: | PF10256 |
---|---|
Interpro abstract (IPR019383): | Proteins in this entry include Golgin subfamily A member 7 and the Ras modification protein ERF4. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Erf4