The domain within your query sequence starts at position 37 and ends at position 405; the E-value for the Es2 domain shown below is 1.9e-76.
RQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGK ISREPPPPYVTPATFETPEVHPGSAVLGNKPRPQGRDLDDAGEAGEEEEKEPLPSLDVFL SQYTSEDNASFQEIMEVAKEKSHARHAWLYQAEEEFEKRQKDNLELPSAEHQAIESSQAG VETWKYKAKNSLMYYPEGVPDEEQLFKKPRQIVHKNTRFLRDPFSQALSRSQLQQAAALN AQHKQGKVGPDGKELIPQESPRVGGFGFVATPSPAPGVNESPLMTWGEVENTPLRVEGSE SPYVDRTPGPTFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSP AMSPALQRL
Es2 |
![]() |
---|
PFAM accession number: | PF09751 |
---|---|
Interpro abstract (IPR019148): | This entry represents a family of proteins known variously as DiGeorge syndrome critical region 14 (DGCR14), DiGeorge syndrome protein I (DGSI), ES2 and ESS-2. In yeast the homologue is known as stress response protein Bis1. Proteins in this family consist of approximately 500 residues with alternating regions of low complexity and conservation where the domain similarities are strong. They contain two predicted coiled-coil regions. ESS-2 has been shown to be involved in pre-mRNA splicing [ (PUBMED:25194163) ]. Similarly DGCR14 has been shown to be a noncore component of the spliceosome C complex [ (PUBMED:22365833) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Es2