The domain within your query sequence starts at position 37 and ends at position 84; the E-value for the FAD_binding_2 domain shown below is 1.3e-6.
DVVVIGGGHAGTEAAAAAARCGSRTLLLTHRVDTIGQMSCNPSFGGIG
FAD_binding_2 |
![]() |
---|
PFAM accession number: | PF00890 |
---|---|
Interpro abstract (IPR003953): | This domain is found in proteins that bind FAD, mainly in FAD-dependent oxidoreductase family 2 proteins, such as the flavoprotein subunits from succinate and fumarate dehydrogenase, and aspartate oxidase [ (PUBMED:8061609) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_2