The domain within your query sequence starts at position 86 and ends at position 143; the E-value for the FAD_binding_3 domain shown below is 9.5e-9.
NTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDTFSRNNVLHLWPFTIHDLRGLGAK
FAD_binding_3 |
---|
PFAM accession number: | PF01494 |
---|---|
Interpro abstract (IPR002938): | This domain is involved in FAD binding in a number of enzymes. |
GO function: | FAD binding (GO:0071949) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_3