The domain within your query sequence starts at position 238 and ends at position 418; the E-value for the FAD_binding_5 domain shown below is 1.2e-46.
ERVTWISPVTLKELVEAKFKYPQAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELGVIS QARDGLTLGAGLSLDQVKDILADIVQKLPEEKTQTYRALLKHLRTLAGSQIRNMASLGGH IVSRHLDSDLNPLLAVGNCTLNLLSKDGERRIPLSEEFLRKCPEADLKPQEVLVSVNIPW S
FAD_binding_5 |
![]() |
---|
PFAM accession number: | PF00941 |
---|---|
Interpro abstract (IPR002346): | Oxidoreductases, that also bind molybdopterin, have essentially no similarity outside this common domain. They include aldehyde oxidase ( EC 1.2.3.1 ), that converts an aldehyde and water to an acid and hydrogen peroxide, and xanthine dehydrogenase ( EC 1.1.1.204 ), that converts xanthine to urate. These enzymes require molybdopterin and FAD as cofactors and have and two 2FE-2S clusters. Another enzyme that contains this domain is the Pseudomonas thermocarboxydovorans carbon monoxide oxygenase. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_5