The domain within your query sequence starts at position 4 and ends at position 55; the E-value for the FAM165 domain shown below is 1.6e-29.
KVLEHVPLLLYILAAKTLILCLAFAGVKMYQRRSLEGKLQAEKRKQSEKKAS
FAM165 |
![]() |
---|
PFAM accession number: | PF14981 |
---|---|
Interpro abstract (IPR028023): | This entry includes small integral membrane protein 11A from vertebrates. Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM165