The domain within your query sequence starts at position 4 and ends at position 55; the E-value for the FAM165 domain shown below is 1.6e-29.

KVLEHVPLLLYILAAKTLILCLAFAGVKMYQRRSLEGKLQAEKRKQSEKKAS

FAM165

FAM165
PFAM accession number:PF14981
Interpro abstract (IPR028023):

This entry includes small integral membrane protein 11A from vertebrates. Its function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM165