The domain within your query sequence starts at position 7 and ends at position 154; the E-value for the FAM176 domain shown below is 3e-63.

DMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISCAPRSRPRTPAPRR
DPRSSTLEPEDEDDEEDEDTMTRLGPDDTLQGQELSTEPDGPLSVNVFTSAEELERAQRL
EERERILREIWRTGQPDLLGSGTLGPGA

FAM176

FAM176
PFAM accession number:PF14851
Interpro abstract (IPR039500):

This entry represents the EVA1 domain found in a group of proteins, including EVA1A/B/C. EVA1A, also known as TMEM166, regulates cell autophagy and apoptosis [ (PUBMED:17492404) (PUBMED:27490928) ].

This domain can be found in the C terminus of the human EVA1C, which serves as the Slit receptor that may mediate neural circuit formation in the developing nervous system. The EVA1C gene is located within the Down syndrome critical region (21q21-21q22.3) [ (PUBMED:24040182) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM176