The domain within your query sequence starts at position 1 and ends at position 159; the E-value for the FAM181 domain shown below is 6e-60.
MAADSDVKMLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLP GRVAEPHLQRGPEERPGRPPLHPCPQSSPGGGGSCTEKALGTPFREECLSKDQGFRGLNP EAARPGQVPMRKRQLPASFWEEPRPTLSYPMGLEVGLAP
FAM181 |
![]() |
---|
PFAM accession number: | PF15238 |
---|---|
Interpro abstract (IPR029359): | This entry represents a group of eukaryotic proteins that are typically between 256 and 426 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM181