The domain within your query sequence starts at position 50 and ends at position 248; the E-value for the FAM184 domain shown below is 7.7e-28.
VIYALNTRQDEVEVSVESIREAHQEDLQDTGAETRTRLPQEQSRTSEDAETLLKRIQTLE NALELQKRLTQEALAESASCKLETKERELRVEAEHAERVLILSKEMLELKADYEKRLQLL TSHEGPQWGQLSQESPDATAESSQRPEMHQVLLEVERLRAENKQLSQDYARKAEELQATY ERENEAIRQAMQQSVSEAL
FAM184 |
---|
PFAM accession number: | PF15665 |
---|---|
Interpro abstract (IPR039478): | This entry represents the N terminus of protein FAM184A/B. The function of FAM184A/B is not known. This domain can also be found in protein tag-278 from C. elegans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM184