The domain within your query sequence starts at position 722 and ends at position 776; the E-value for the FAM193_C domain shown below is 9.6e-32.

DDVFLPKDLDGVEMDETDREVEYFKRFCLDSAKQTRQKVAVNWTNFSLKKTTPST

FAM193_C

FAM193_C
PFAM accession number:PF15914
Interpro abstract (IPR031802):

This C-terminal region of uncharacterised protein family FAM193 carries the most conserved residues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM193_C