The domain within your query sequence starts at position 722 and ends at position 776; the E-value for the FAM193_C domain shown below is 9.6e-32.
DDVFLPKDLDGVEMDETDREVEYFKRFCLDSAKQTRQKVAVNWTNFSLKKTTPST
FAM193_C |
---|
PFAM accession number: | PF15914 |
---|---|
Interpro abstract (IPR031802): | This C-terminal region of uncharacterised protein family FAM193 carries the most conserved residues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM193_C