The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the FAM198 domain shown below is 5.4e-27.
MALFDFLLQIYNRLDTNCCGFRPRKEDACIQNGLRSNCEDQTSVTLAHIIQ
FAM198 |
![]() |
---|
PFAM accession number: | PF15051 |
---|---|
Interpro abstract (IPR029207): | This family of proteins is found in eukaryotes. The function of this family is unknown. Murine FAM198B is downregulated by FGFR signalling [ (PUBMED:17174081) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM198