The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the FAM198 domain shown below is 5.4e-27.

MALFDFLLQIYNRLDTNCCGFRPRKEDACIQNGLRSNCEDQTSVTLAHIIQ

FAM198

FAM198
PFAM accession number:PF15051
Interpro abstract (IPR029207):

This family of proteins is found in eukaryotes. The function of this family is unknown. Murine FAM198B is downregulated by FGFR signalling [ (PUBMED:17174081) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM198