The domain within your query sequence starts at position 37 and ends at position 168; the E-value for the FAM219A domain shown below is 1.6e-57.
EKQRELARKGSLKNGSMGSPVNQQPKKNNVMARTRLVVPNKGYSSLDQSPDEKPLVALDT DSDDDFDMSRYSSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMC CQATSSTACHIQ
FAM219A |
![]() |
---|
PFAM accession number: | PF15260 |
---|---|
Interpro abstract (IPR029339): | This entry represents a group of eukaryotic proteins that are typically between 144 and 191 amino acids in length. There are two conserved sequence motifs: QLL and LDE. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM219A