The domain within your query sequence starts at position 30 and ends at position 98; the E-value for the FAM24 domain shown below is 4.1e-39.
LYQKISKALKLAKEPECCIDPCKDPNEKIIRAKPIIAETCRNLPCCDDCSIYKDVGSLPP CYCVTNEGL
FAM24 |
 |
|---|
| PFAM accession number: | PF15193 |
|---|---|
| Interpro abstract (IPR028122): | This family of proteins is found in eukaryotes. There are two conserved sequence motifs: FDLRT and CLY. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM24