The domain within your query sequence starts at position 694 and ends at position 866; the E-value for the FAM35_C domain shown below is 4.6e-84.
DKYSGVVLIKAKVSELVFSAAAAQKIALNARSTLQSIFSSLPSIVYAGCAHCGSELETDE NRIYRQCLSCLPFVGKKIFYRPALMTIVDGRYNTCVHVGSKMMEQILLNISPDCLNRVIV PSSEVTYGMVASDLLHSLLAVSAEPCVLKIQSLFELDENSYPLQQDFSLLDFC
FAM35_C |
![]() |
---|
PFAM accession number: | PF15793 |
---|---|
Interpro abstract (IPR031589): | This domain is found in C-terminal of the protein FAM35A from eukaryotes. Its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM35_C