The domain within your query sequence starts at position 1 and ends at position 100; the E-value for the FAM86 domain shown below is 2.7e-62.
MAPEDHEGATSLLQSFERRFLAARALPSFPWQSLEEKLKDPSGSELLLAILQRTVKHPVC VQHGPSVKYARCFLSKLIKKHEAVPTEPLDALYEALAEVL
FAM86 |
---|
PFAM accession number: | PF14904 |
---|---|
Interpro abstract (IPR029426): | This conserved domain can be found at the N terminus of EEF2KMT (also known as FAM86A), FAM86B and related proteins. EEF2KMT (also known as Efm3 in budding yeasts) catalyzes the trimethylation of eukaryotic elongation factor 2 (EEF2) on 'Lys-525' [ (PUBMED:25086354) (PUBMED:25231979) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM86