The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the FANCI_S1-cap domain shown below is 4.5e-29.
MDLKILSLATDKTTDKLQEFLQTLKDDDLASLLQNQAVKGRAVGTLLRAVLKG
FANCI_S1-cap |
---|
PFAM accession number: | PF14674 |
---|---|
Interpro abstract (IPR029305): | FANCI and FANCD2 form a complex central to the Fanconi anemia (FA) pathway, which is essential for the repair of DNA interstrand cross-links. FANCI has four distinct alpha solenoid (alpha-alpha superhelical) segments (S1-S4). Two mostly helical segments intervene between solenoids 1 and 2 (HD1), and between solenoids 2 and 3 (HD2) [ (PUBMED:21764741) ]. This entry represents the solenoid 1 cap (S1-cap) domain of the Fanconi anemia complementation group I protein (FANCI). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCI_S1-cap