The domain within your query sequence starts at position 404 and ends at position 459; the E-value for the FAO_M domain shown below is 1.2e-19.
YGYPSENVWELDLQRFGALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTS
FAO_M |
![]() |
---|
PFAM accession number: | PF16350 |
---|---|
Interpro abstract (IPR032503): | This domain occurs in several FAD dependent oxidoreductases: sarcosine dehydrogenase, dimethylglycine dehydrogenase and dimethylglycine oxidase. It's function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAO_M