The domain within your query sequence starts at position 65 and ends at position 294; the E-value for the FA_desaturase domain shown below is 3.3e-25.
SWRWLLFWAYAFGGCINHSLTLAIHDISHNTAFGTSCVSRNRWFAIFANLPIGLPYATSF KKYHVDHHRYLGGDGLDVDIPTNFEGWFFCTPARKLLWLVLQPFFYSLRPLCVNPKVVTR MEILNALVQLAFDVTIFALWGIKPIVYLLGSSLLGLGLHPISGHFVAEHYMFLKGHETYS YYGPLNWITFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWV
FA_desaturase |
![]() |
---|
PFAM accession number: | PF00487 |
---|---|
Interpro abstract (IPR005804): | Fatty acid desaturases are enzymes that catalyse the insertion of a double bond at the delta position of fatty acids. There seem to be two distinct families of fatty acid desaturases which do not seem to be evolutionary related. Family 1 is composed of:
Family 2 is composed of:
|
GO process: | lipid metabolic process (GO:0006629) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FA_desaturase