The domain within your query sequence starts at position 65 and ends at position 294; the E-value for the FA_desaturase domain shown below is 3.3e-25.

SWRWLLFWAYAFGGCINHSLTLAIHDISHNTAFGTSCVSRNRWFAIFANLPIGLPYATSF
KKYHVDHHRYLGGDGLDVDIPTNFEGWFFCTPARKLLWLVLQPFFYSLRPLCVNPKVVTR
MEILNALVQLAFDVTIFALWGIKPIVYLLGSSLLGLGLHPISGHFVAEHYMFLKGHETYS
YYGPLNWITFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWV

FA_desaturase

 FA_desaturase
PFAM accession number:PF00487
Interpro abstract (IPR005804):

Fatty acid desaturases are enzymes that catalyse the insertion of a double bond at the delta position of fatty acids. There seem to be two distinct families of fatty acid desaturases which do not seem to be evolutionary related.

Family 1 is composed of:

Family 2 is composed of:

  • Bacterial fatty acid desaturases.
  • Plant stearoyl-acyl-carrier-protein desaturase ( EC 1.14.19.1 ) [ (PUBMED:2006187) ], this enzyme catalyzes the introduction of a double bond at the delta(9) position of steraoyl-ACP to produce oleoyl-ACP. This enzyme is responsible for the conversion of saturated fatty acids to unsaturated fatty acids in the synthesis of vegetable oils.
  • Cyanobacterial DesA [ (PUBMED:2118597) ], an enzyme that can introduce a second cis double bond at the delta(12) position of fatty acid bound to membranes glycerolipids. DesA is involved in chilling tolerance; the phase transition temperature of lipids of cellular membranes being dependent on the degree of unsaturation of fatty acids of the membrane lipids.
GO process:lipid metabolic process (GO:0006629)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FA_desaturase