The domain within your query sequence starts at position 123 and ends at position 253; the E-value for the FA_hydroxylase domain shown below is 6.1e-27.
VVSFLFFTDMLIYWIHRGLHHRLVYKRIHKPHHIWKIPTPFASHAFHPVDGFLQSLPYHI YPFVFPLHKVVYLGLYVLVNVWTISIHDGDFRVPQILRPFINGSAHHTDHHMFFDYNYGQ YFTLWDRIGGS
FA_hydroxylase |
---|
PFAM accession number: | PF04116 |
---|---|
Interpro abstract (IPR006694): | This entry includes fatty acid and carotene hydroxylases and sterol desaturases. Beta-carotene hydroxylase is involved in zeaxanthin synthesis by hydroxylating beta-carotene, but the enzyme may be involved in other pathways [ (PUBMED:8718622) ]. This family includes C-5 sterol desaturase [ (PUBMED:10344195) ] and C-4 sterol methyl oxidase (SMO) [ (PUBMED:14653780) (PUBMED:12880870) ]. Members of this family are involved in cholesterol biosynthesis and biosynthesis a plant cuticular wax. These enzymes contain two copies of a HXHH motif. Members of this family are integral membrane proteins. The plant SMO amino acid sequences possess three histidine-rich motifs (HX3H, HX2HH and HX2HH), characteristic of the small family of membrane-bound non-haem iron oxygenases that are involved in lipid oxidation [ (PUBMED:14653780) ]. |
GO process: | lipid biosynthetic process (GO:0008610), oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491), iron ion binding (GO:0005506) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FA_hydroxylase