The domain within your query sequence starts at position 3 and ends at position 172; the E-value for the FCP1_C domain shown below is 3.8e-92.
CITLVVRAVQPHQQQMFGEELPESQDGEQPGPARRKRQPSMSEAMPLYTLCKEDLESMDK EVDDILGEGSDDSDIEKKKPEDQDNEQERAPKPRKPRAPGIRREQPVGLPSSGERSTPGM RGPRGHKRKLNEEDAASESSGESSNDDEEGSSSEADEMAAALEAELNDLM
FCP1_C |
---|
PFAM accession number: | PF09309 |
---|---|
Interpro abstract (IPR015388): | The C-terminal domain of FCP-1 is required for interaction with the carboxy terminal domain of RAP74. Interaction relies extensively on van der Waals contacts between hydrophobic residues situated within alpha-helices in both domains [ (PUBMED:12732728) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FCP1_C