The domain within your query sequence starts at position 42 and ends at position 284; the E-value for the FEZ domain shown below is 7.2e-106.
SFPALASSLEEKLSLCFRPTSEAEPPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVDW KSSHTRTLHLLTLNLSEKGMNDGLLFDASDEEELREQLDMHSIIVSCVNEEPLFTADQVI EEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSMSSYEERVKRLSVSELNELLE EIEAAIKQYSEELVQQLALRDELEFEKEVENSFISALIEVQNKQKEHKETAKKKKKLKSG SSQ
FEZ |
![]() |
---|
PFAM accession number: | PF07763 |
---|---|
Interpro abstract (IPR011680): | The first member of the FEZ (fasciculation and elongation protein zeta) family identified was unc-76, from C. elegans. The protein is necessary for normal axon fasciculation and is required for axon-axon interactions [ (PUBMED:9096408) ]. Later, two human homologues, FEZ1 and FEZ2, were identified [ (PUBMED:8401577) ]. FEZ1 and FEZ2 interact with PKCzeta and have been shown to induce neurite extension of PC12 cells when co-expressed with a constitutively active mutant of PKCzeta [ (PUBMED:14697253) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FEZ