SMART: Pfam domain FEZ

The domain within your query sequence starts at position 58 and ends at position 123; the E-value for the FEZ domain shown below is 6.3e-29.

SMEDLVNEFDEKLNVCFRNYNAKTESLAPVKNQLQIQEEEETLRDEEVWDALTDNYIPSL
SEDWRD

FEZ

PFAM accession number:	PF07763
Interpro abstract (IPR011680):	The first member of the FEZ (fasciculation and elongation protein zeta) family identified was unc-76, from C. elegans. The protein is necessary for normal axon fasciculation and is required for axon-axon interactions [ (PUBMED:9096408) ]. Later, two human homologues, FEZ1 and FEZ2, were identified [ (PUBMED:8401577) ]. FEZ1 and FEZ2 interact with PKCzeta and have been shown to induce neurite extension of PC12 cells when co-expressed with a constitutively active mutant of PKCzeta [ (PUBMED:14697253) ].

PFAM accession number:

PF07763

Interpro abstract (IPR011680):

The first member of the FEZ (fasciculation and elongation protein zeta) family identified was unc-76, from C. elegans. The protein is necessary for normal axon fasciculation and is required for axon-axon interactions [ (PUBMED:9096408) ]. Later, two human homologues, FEZ1 and FEZ2, were identified [ (PUBMED:8401577) ]. FEZ1 and FEZ2 interact with PKCzeta and have been shown to induce neurite extension of PC12 cells when co-expressed with a constitutively active mutant of PKCzeta [ (PUBMED:14697253) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FEZ