The domain within your query sequence starts at position 13 and ends at position 105; the E-value for the FKBP_C domain shown below is 1.3e-35.
GRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQR AKLIISSDYAYGATGHPGIIPPHATLVFDVELL
FKBP_C |
---|
PFAM accession number: | PF00254 |
---|---|
Interpro abstract (IPR001179): | This entry represents a domain found in FKBP-type peptidylprolyl isomerases. FKBP-type peptidylprolyl isomerases ( EC 5.2.1.8 ) in vertebrates, are receptors for the two immunosuppressants, FK506 and rapamycin. The drugs inhibit T cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. Peptidylprolyl isomerases accelerate protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides. These proteins are found in a variety of organisms. |
GO function: | peptidyl-prolyl cis-trans isomerase activity (GO:0003755) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FKBP_C