The domain within your query sequence starts at position 1 and ends at position 106; the E-value for the FLYWCH_N domain shown below is 2.4e-47.
MPQPKPSEQEGESMKASQEPAPQPGTDVVPAAPRKPRKFSKLVLLTASKDSAKVAGAKRK GVHCIMSLGVPGPATLAKALLKTHPEAQRAIEATPLEPEQKRSKQN
FLYWCH_N |
---|
PFAM accession number: | PF15423 |
---|---|
Interpro abstract (IPR029279): | This entry represents the N terminus of some FLYWCH-zinc-finger proteins, found in eukaryotes. The family is found in association with IPR007588 . There are two conserved sequence motifs: EQE and QEPS. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FLYWCH_N