The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the FLYWCH_N domain shown below is 6.1e-18.

XVAGAKRKGVHCIMSLGVPGPATLAKALLKTHPEAQRAIEATPLEPEQKRSKQN

FLYWCH_N

FLYWCH_N
PFAM accession number:PF15423
Interpro abstract (IPR029279):

This entry represents the N terminus of some FLYWCH-zinc-finger proteins, found in eukaryotes. The family is found in association with IPR007588 . There are two conserved sequence motifs: EQE and QEPS.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FLYWCH_N